PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G08830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 257aa    MW: 27362.7 Da    PI: 6.1707
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G08830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.8e-11130174549
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++
  LPERR02G08830.1 130 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRV 174
                      899********************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13126190IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611128184IPR004827Basic-leucine zipper domain
PfamPF001707.6E-10130179IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11130184No hitNo description
Gene3DG3DSA:1.20.5.1706.3E-14130184No hitNo description
CDDcd147037.50E-23131181No hitNo description
PROSITE patternPS000360133148IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MAQLPPRAPA SNSAGQEWAA AGDFLGFAAA RRGAHRRSAS DSAAFLEAVP MDDVIGGGGE  60
FDRLDDEQLM SMFSDVEAPA VSDGAGGERG AGEAHLMDMG DGEDEMGATS PAAARAMAAA  120
AAADGIADPK RVKRILANRQ SAQRSRVRKL QYISELERSV TTLQMEVSAL SPRVAFLDHQ  180
RSLLTVGNSH LKQRIAALAQ DKIFKDAHQE ALKNEIERLR QLYHQQQIKA TGGTDIAAAA  240
SMQAKHELLA CEGAAMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951321.11e-130PREDICTED: basic leucine zipper 19-like
SwissprotQ6K3R91e-122BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0D9VE890.0A0A0D9VE89_9ORYZ; Uncharacterized protein
STRINGSi018161m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.18e-57bZIP family protein